PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g124900.1
Common NameMTR_4g124900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARF
Protein Properties Length: 1121aa    MW: 125415 Da    PI: 6.5113
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g124900.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B368.21.1e-21126227199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      +++++  ++l+ +d++ ++W +++iyr++++r++lt+GW+ F + ++L +gD+v+F   +++
  Medtr4g124900.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfSMQPPA-QELVAKDLHDNTWAFRHIYRGQPKRHLLTTGWSVFISTKRLFAGDSVLFI--RDE 216
                      99*****************************9445444.38************************************************..567 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      +++l+++++r+
  Medtr4g124900.1 217 KQQLLLGLRRA 227
                      88899999986 PP

2Auxin_resp125.14.9e-41252334183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaa+++s+F+++YnPras+seFvv+++k++ka++++vs+GmRf+m+fete+s  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Medtr4g124900.1 252 AAHAAANNSPFTIYYNPRASPSEFVVPLAKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 334
                      79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-40118241IPR015300DNA-binding pseudobarrel domain
CDDcd100172.69E-17125217No hitNo description
PROSITE profilePS5086311.885126228IPR003340B3 DNA binding domain
PfamPF023627.8E-20126227IPR003340B3 DNA binding domain
SMARTSM010192.7E-21126228IPR003340B3 DNA binding domain
PfamPF065074.5E-36252334IPR010525Auxin response factor
PfamPF023092.9E-99881079IPR033389AUX/IAA domain
PROSITE profilePS5174525.0289931086IPR000270PB1 domain
SuperFamilySSF542771.28E-89971071No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1121 aa     Download sequence    Send to blast
MKAPNNGYMP NSGEGERKTI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKQ  60
TDFIPSYPNL PSKLICMLHN VALHADPETD EVYAQMTLQP VNKYDKDAIL ASDFGLKQNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQELVAKD LHDNTWAFRH  180
IYRGQPKRHL LTTGWSVFIS TKRLFAGDSV LFIRDEKQQL LLGLRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIYYNPRA SPSEFVVPLA KYNKAMYTQV SLGMRFRMMF  300
ETEESGVRRY MGTVTGISDL DPVRWKNSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR QNFPGHPGMP DDGSDVENSF KRAMPWLGDD FGMKDASSSV FPGLSLVQWM  420
SMQQKNQFSG AQSGCFPSML SSNTLHSNLS TDDPSKLLSF QAPALSAPNL QFNKPNLPNQ  480
INQLQQSPTS WPQQQQQQQQ PLQQQQQQQQ QQQQQLQSLS QIPMNQFQQQ RQQQLPESQN  540
LTLLQQQITH QLQKQPQSSQ HAIMNNGVVA SNQITNQFQQ PQPLAYAQLQ QQQQLLQGSI  600
PLQQSIQSAS KNAFPLTSLP HDSQFHQQID QQASLSQRQQ QQTQSQQSSL QALQQSQPQR  660
VQPNLQATQM SQQNTSEQQL QLQFLQKLQQ QQQQQQLLST SNPLLQSQLL QQQNTNQQNQ  720
QLSQLPISQH HNQQFGNNAF STEKLLNSNN LSSSSLMQSQ QLSVNQTRNT QKPLTITRVP  780
STLTDGEAPS CSTSPSTNNC RITQPNLLKR NQQVPTTIGG ILAVEPTSNL IHDLQSKSDM  840
HIKHEFSNVK GSDQLKYKGT TTDQLEASSG TSYCLDPGNV QQNLPLSNFC MEGDVQSNPR  900
INLPFDSNLD GLMSDTMLSR GFDSQKDLQN LLSNYDAAPR DIETELSTAD ISSQSFGLPD  960
MSFKPGCSND VGINDTSGVL NNGLRANQNQ RMRTYTKVQK RGSVGRCIDV TRYKGYDELR  1020
YDLARMFGIE GQLEDPQRTD WKLVYVDHEN DILLVGDDPW EEFVSCVQSI KILSSAEVQQ  1080
MSLDGDLGNV TIPNQASSGT DSGNAWRGQY DDNSAASFNR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1741535545388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1444830.0AC144483.10 Medicago truncatula chromosome 8 clone mth2-12f13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003609970.10.0auxin response factor 2
TrEMBLG7JS690.0G7JS69_MEDTR; Auxin response factor
STRINGGLYMA17G05220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49183352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]